Lineage for d5jysa_ (5jys A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535431Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2535432Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2535462Family d.111.1.0: automated matches [227200] (1 protein)
    not a true family
  6. 2535463Protein automated matches [226929] (4 species)
    not a true protein
  7. 2535464Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [319772] (1 PDB entry)
  8. 2535465Domain d5jysa_: 5jys A: [319773]
    automated match to d4aiwa_
    complexed with mg

Details for d5jysa_

PDB Entry: 5jys (more details), 1.9 Å

PDB Description: pry1 cap domain
PDB Compounds: (A:) Protein PRY1

SCOPe Domain Sequences for d5jysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jysa_ d.111.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
lsdfassvlaehnkkralhkdtpalswsdtlasyaqdyadnydcsgtlthsggpygenla
lgydgpaavdawyneisnydfsnpgfssntghftqvvwksttqvgcgiktcggawgdyvi
csydpagnyegeyadnvepla

SCOPe Domain Coordinates for d5jysa_:

Click to download the PDB-style file with coordinates for d5jysa_.
(The format of our PDB-style files is described here.)

Timeline for d5jysa_: