Lineage for d5fw5b_ (5fw5 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937244Species Human (Homo sapiens) [TaxId:9606] [189642] (4 PDB entries)
  8. 2937250Domain d5fw5b_: 5fw5 B: [319749]
    Other proteins in same PDB: d5fw5a2
    automated match to d4fcja_
    complexed with act, gol, k, so4

Details for d5fw5b_

PDB Entry: 5fw5 (more details), 1.92 Å

PDB Description: crystal structure of human g3bp1 in complex with semliki forest virus nsp3-25 comprising two fgdf motives
PDB Compounds: (B:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d5fw5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fw5b_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqkeihrk
vmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvankf
yvhndifryqd

SCOPe Domain Coordinates for d5fw5b_:

Click to download the PDB-style file with coordinates for d5fw5b_.
(The format of our PDB-style files is described here.)

Timeline for d5fw5b_: