Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (35 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189642] (4 PDB entries) |
Domain d5fw5b_: 5fw5 B: [319749] Other proteins in same PDB: d5fw5a2 automated match to d4fcja_ complexed with act, gol, k, so4 |
PDB Entry: 5fw5 (more details), 1.92 Å
SCOPe Domain Sequences for d5fw5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fw5b_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqkeihrk vmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvankf yvhndifryqd
Timeline for d5fw5b_: