Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (20 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [319715] (2 PDB entries) |
Domain d5d6rb3: 5d6r B:367-556 [319744] Other proteins in same PDB: d5d6rb2, d5d6rm2, d5d6rm4 automated match to d1ozga3 complexed with en0, mg, po4 |
PDB Entry: 5d6r (more details), 2.28 Å
SCOPe Domain Sequences for d5d6rb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d6rb3 c.36.1.0 (B:367-556) automated matches {Klebsiella pneumoniae [TaxId: 573]} nqfalhplrivramqdivnsdvtltvdmgsfhiwiarylysfrarqvmisngqqtmgval pwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeek kyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdn pllmgqlhls
Timeline for d5d6rb3:
View in 3D Domains from other chains: (mouse over for more information) d5d6rm1, d5d6rm2, d5d6rm3, d5d6rm4 |