Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (14 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [319717] (3 PDB entries) |
Domain d5d6rb2: 5d6r B:188-366 [319743] Other proteins in same PDB: d5d6rb1, d5d6rb3, d5d6rm1, d5d6rm3, d5d6rm4 automated match to d1ozha1 complexed with en0, mg, po4 |
PDB Entry: 5d6r (more details), 2.28 Å
SCOPe Domain Sequences for d5d6rb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d6rb2 c.31.1.0 (B:188-366) automated matches {Klebsiella pneumoniae [TaxId: 573]} qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql
Timeline for d5d6rb2:
View in 3D Domains from other chains: (mouse over for more information) d5d6rm1, d5d6rm2, d5d6rm3, d5d6rm4 |