Lineage for d5d6rm1 (5d6r M:1-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865322Species Klebsiella pneumoniae [TaxId:573] [319715] (3 PDB entries)
  8. 2865333Domain d5d6rm1: 5d6r M:1-187 [319716]
    Other proteins in same PDB: d5d6rb2, d5d6rm2, d5d6rm4
    automated match to d1ozha2
    complexed with en0, mg, po4

Details for d5d6rm1

PDB Entry: 5d6r (more details), 2.28 Å

PDB Description: acetolactate synthase from klebsiella pneumoniae in complex with mechanism-based inhibitor
PDB Compounds: (M:) Acetolactate synthase, catabolic

SCOPe Domain Sequences for d5d6rm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d6rm1 c.36.1.0 (M:1-187) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheana
afmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhq
smdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkv
lpasgap

SCOPe Domain Coordinates for d5d6rm1:

Click to download the PDB-style file with coordinates for d5d6rm1.
(The format of our PDB-style files is described here.)

Timeline for d5d6rm1: