SCOPe 2.08: Domain d821pa_: 821p A:

Lineage for d821pa_ (821p A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (160 PDB entries)
   Uniprot Q6P716

8. Domain d821pa_: 821p A: [31969]
   complexed with gnp, mg; mutant

Details for d821pa_

PDB Entry: 821p, 1.5 Å

PDB Description: three-dimensional structures and properties of a transforming and a nontransforming glycine-12 mutant of p21h-ras

PDB Compounds: (A:) c-h-ras p21 protein

SCOPe Domain Sequences for d821pa_:

Sequence; same for both SEQRES and ATOM records:

>d821pa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d821pa_:

• d821pa_ first appeared (with stable ids) in SCOP 1.55, called d821p__
  
• d821pa_ appears in SCOPe 2.07