SCOPe 2.08: Domain d5bw0c1: 5bw0 C:42-203

Lineage for d5bw0c1 (5bw0 C:42-203)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.0: automated matches [233575] (1 protein)
   not a true family

6. Protein automated matches [233576] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [255339] (5 PDB entries)

8. Domain d5bw0c1: 5bw0 C:42-203 [319672]
   automated match to d3njea_
   complexed with so4

Details for d5bw0c1

PDB Entry: 5bw0, 2 Å

PDB Description: the crystal structure of minor pseudopilin binary complex of xcpv and xcpw from the type 2 secretion system of pseudomonas aeruginosa

PDB Compounds: (C:) Type II secretion system protein J

SCOPe Domain Sequences for d5bw0c1:

Sequence, based on SEQRES records:

>d5bw0c1 d.24.1.0 (C:42-203) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
vqeqrmrelvramgalerdltqaverpvrdelgdnrgaflsegendqiveftrggwrnpl
gqarsrlqrvrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwqg
hwptdegseeerleslplavemtlehrhygklvrvwrlldpp

Sequence, based on observed residues (ATOM records):

>d5bw0c1 d.24.1.0 (C:42-203) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
vqeqrmrelvramgalerdltqaverpvrdelgdnrgaflsegendqiveftrgrlqrvr
wslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwqghwpteerlesl
plavemtlehrhygklvrvwrlldpp

Timeline for d5bw0c1:

• d5bw0c1 first appeared in SCOPe 2.06
  
• d5bw0c1 appears in SCOPe 2.07