SCOPe 2.08: Domain d5jo5d2: 5jo5 D:107-210

Lineage for d5jo5d2 (5jo5 D:107-210)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d5jo5d2: 5jo5 D:107-210 [319654]
Other proteins in same PDB: d5jo5a_, d5jo5b1, d5jo5c_, d5jo5d1, d5jo5e_, d5jo5f1, d5jo5h_, d5jo5l1
automated match to d5azel2

Details for d5jo5d2

PDB Entry: 5jo5 (more details), 1.7 Å

PDB Description: crystal structure of 10e8 ghv-glv antigen-binding fragment.

PDB Compounds: (D:) 10E8 gLV

SCOPe Domain Sequences for d5jo5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jo5d2 b.1.1.2 (D:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d5jo5d2:

Click to download the PDB-style file with coordinates for d5jo5d2.
(The format of our PDB-style files is described here.)

Timeline for d5jo5d2: