SCOPe 2.08: Domain d5jr1l1: 5jr1 L:2-107

Lineage for d5jr1l1 (5jr1 L:2-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5jr1l1: 5jr1 L:2-107 [319634]
   Other proteins in same PDB: d5jr1h_, d5jr1l2
   automated match to d1lila1
   complexed with zn

Details for d5jr1l1

PDB Entry: 5jr1, 1.6 Å

PDB Description: crystal structure of 10e8 ghv-maturel antigen-binding fragment.

PDB Compounds: (L:) 10E8 mature light chain

SCOPe Domain Sequences for d5jr1l1:

Sequence; same for both SEQRES and ATOM records:

>d5jr1l1 b.1.1.0 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqetgvsvalgrtvtitcrgdslrshyaswyqkkpgqapillfygknnrpsgvpdrf
sgsasgnrasltisgaqaeddaeyycssrdksgsrlsvfgggtkltvls

Timeline for d5jr1l1:

• d5jr1l1 first appeared in SCOPe 2.06
  
• d5jr1l1 appears in SCOPe 2.07