SCOPe 2.06: Domain d5l7xl2: 5l7x L:108-213

Lineage for d5l7xl2 (5l7x L:108-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)

8. Domain d5l7xl2: 5l7x L:108-213 [319628]
   Other proteins in same PDB: d5l7xl1
   automated match to d1tqbc2
   complexed with 1pe, nag, peg, pg4

Details for d5l7xl2

PDB Entry: 5l7x, 1.86 Å

PDB Description: afamin antibody fragment, n14 fab, l1- glycosylated, crystal form ii

PDB Compounds: (L:) Mouse Antibody Fab Fragment, IgG1-kappa Light Chain

SCOPe Domain Sequences for d5l7xl2:

Sequence; same for both SEQRES and ATOM records:

>d5l7xl2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d5l7xl2:

• d5l7xl2 is new in SCOPe 2.06-stable
  
• d5l7xl2 appears in SCOPe 2.07
  
• d5l7xl2 appears in the current release, SCOPe 2.08