Lineage for d5jzgc_ (5jzg C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410774Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2410775Protein automated matches [190988] (15 species)
    not a true protein
  7. 2410840Species Rhinovirus c [TaxId:463676] [319565] (2 PDB entries)
  8. 2410844Domain d5jzgc_: 5jzg C: [319566]
    automated match to d1pov0_

Details for d5jzgc_

PDB Entry: 5jzg (more details), 3.16 Å

PDB Description: cryoem structure of the native empty particle of a human rhinovirus c
PDB Compounds: (C:) capsid protein VP0

SCOPe Domain Sequences for d5jzgc_:

Sequence, based on SEQRES records: (download)

>d5jzgc_ b.121.4.0 (C:) automated matches {Rhinovirus c [TaxId: 463676]}
gaqvsrqnngthengvtasngsvikyfninyykdsassglsrqdfsqdpskftqplvdtl
tnpalmspsveacgysdrlkqitignstittqdslhtvlaygewptylsdidatsvdkpt
hpetsadrfytldsvewqvgshgwwwklpdalkdmgvfgqnmyyhsmgrsgfiihtqcna
tkfhsgalivavipehqlayvggvkvnvgydhthpgqsghqirgpsqsndrsggkpdedp
lfncngtllgnitifphqiinlrtnnsstivvpyincvpmdnmlkhnnlslviiplvplr
pgssginsvpitvtiapyksefsgameaqrq

Sequence, based on observed residues (ATOM records): (download)

>d5jzgc_ b.121.4.0 (C:) automated matches {Rhinovirus c [TaxId: 463676]}
gaqvssvikyfninyykdsassglsrqdfsqdpstltnpalmspsveacgysdrqitign
stittslhtvlaygewptylsdidatsvdkpthpetsadrfytldsvewqvgshgwwwkl
pdalkdmgvfgqnmyyhsmgrsgfiihtqcnatkfhsgalivavipehqlayvggvkvnv
gydhthpgqsghqirgpsqsndrsggkpdedplfncngtllgnitifphqiinlrtnnss
tivvpyincvpmdnmlkhnnlslviiplvplrpgssginsvpitvtiapyksefsgamea
qrq

SCOPe Domain Coordinates for d5jzgc_:

Click to download the PDB-style file with coordinates for d5jzgc_.
(The format of our PDB-style files is described here.)

Timeline for d5jzgc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5jzgb_