Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein 1-Cys peroxiredoxin [52909] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [52910] (3 PDB entries) |
Domain d5b6me_: 5b6m E: [319559] automated match to d1prxb_ |
PDB Entry: 5b6m (more details), 2.5 Å
SCOPe Domain Sequences for d5b6me_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b6me_ c.47.1.10 (E:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} glllgdvapnfeanttvgrirfhdflgdswgilfshprdftpvcttelgraaklapefak rnvklialsidsvedhlawskdinaynceepteklpfpiiddrnrelaillgmldpaekd ekgmpvtarvvfvfgpdkklklsilypattgrnfdeilrvvislqltaekrvatpvdwkd gdsvmvlptipeeeakklfpkgvftkelpsgkkylrytpqp
Timeline for d5b6me_: