SCOPe 2.06: Domain d5cf0a_: 5cf0 A:

Lineage for d5cf0a_ (5cf0 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (141 PDB entries)

8. Domain d5cf0a_: 5cf0 A: [319548]
   automated match to d2xjxa_
   complexed with fjs

Details for d5cf0a_

PDB Entry: 5cf0, 1.8 Å

PDB Description: crystal structure of the human hsp90-alpha n-domain bound to the hsp90 inhibitor fj6

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d5cf0a_:

Sequence; same for both SEQRES and ATOM records:

>d5cf0a_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfvek

Timeline for d5cf0a_:

• d5cf0a_ is new in SCOPe 2.06-stable
  
• d5cf0a_ appears in SCOPe 2.07
  
• d5cf0a_ appears in the current release, SCOPe 2.08