Lineage for d5jdbd_ (5jdb D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781279Species Rotavirus a [TaxId:28875] [277665] (11 PDB entries)
  8. 2781298Domain d5jdbd_: 5jdb D: [319537]
    automated match to d2dwra_

Details for d5jdbd_

PDB Entry: 5jdb (more details), 1.9 Å

PDB Description: binding specificity of p[8] vp8* proteins of rotavirus vaccine strains with histo-blood group antigens
PDB Compounds: (D:) Outer capsid protein VP4

SCOPe Domain Sequences for d5jdbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jdbd_ b.29.1.0 (D:) automated matches {Rotavirus a [TaxId: 28875]}
ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
ttdssntanlndisiiihsefyiiprsqeskcneyinngl

SCOPe Domain Coordinates for d5jdbd_:

Click to download the PDB-style file with coordinates for d5jdbd_.
(The format of our PDB-style files is described here.)

Timeline for d5jdbd_: