Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (53 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [227626] (4 PDB entries) |
Domain d5it6a_: 5it6 A: [319521] automated match to d3b9ca_ complexed with edo, peg, pge, so4 |
PDB Entry: 5it6 (more details), 1.55 Å
SCOPe Domain Sequences for d5it6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5it6a_ b.29.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} pfcghikggmrpgkkilvmgivdlnpesfgisltcgesedppadvaielkavftdrqfir nscvagewgeeqssipyfpfipdqpfrveilcehprfrifvdghqlfdfyhrietlsaid tikingdlqltklg
Timeline for d5it6a_: