Lineage for d1nsta_ (1nst A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23081Family c.37.1.5: PAPS sulfotransferase [52575] (4 proteins)
  6. 23093Protein Heparan sulfate N-deacetylase/N-sulfotransferase domain [52582] (1 species)
  7. 23094Species Human (Homo sapiens) [TaxId:9606] [52583] (1 PDB entry)
  8. 23095Domain d1nsta_: 1nst A: [31951]

Details for d1nsta_

PDB Entry: 1nst (more details), 2.3 Å

PDB Description: the sulfotransferase domain of human haparin sulfate n-deacetylase/n- sulfotransferase

SCOP Domain Sequences for d1nsta_:

Sequence, based on SEQRES records: (download)

>d1nsta_ c.37.1.5 (A:) Heparan sulfate N-deacetylase/N-sulfotransferase domain {Human (Homo sapiens)}
dplwqdpcedkrhkdiwskektcdrfpklliigpqktgttalylflgmhpdlssnypsse
tfeeiqffnghnyhkgidwymeffpipsnttsdfyfeksanyfdsevaprraaallpkak
vltilinpadrayswyqhqrahddpvalkytfhevitagsdassklralqnrclvpgwya
thierwlsayhanqilvldgkllrtepakvmdmvqkflgvtntidyhktlafdpkkgfwc
qlleggktkclgkskgrkypemdldsraflkdyyrdhnielskllykmgqtlptwlredl
q

Sequence, based on observed residues (ATOM records): (download)

>d1nsta_ c.37.1.5 (A:) Heparan sulfate N-deacetylase/N-sulfotransferase domain {Human (Homo sapiens)}
dplwqdpccdrfpklliigpqktgttalylflgmhpdlssnypssetfeeiqffnghnyh
kgidwymeffpisdfyfeksanyfdsevaprraaallpkakvltilinpadrayswyqhq
rahddpvalkytfhevitagsdassklralqnrclvpgwyathierwlsayhanqilvld
gkllrtepakvmdmvqkflgvtntidyhktlafdpkkgfwcqlleggktkclgkskgrky
pemdldsraflkdyyrdhnielskllykmgqtlptwlredlq

SCOP Domain Coordinates for d1nsta_:

Click to download the PDB-style file with coordinates for d1nsta_.
(The format of our PDB-style files is described here.)

Timeline for d1nsta_: