SCOPe 2.08: Domain d5g2gb_: 5g2g B:

Lineage for d5g2gb_ (5g2g B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
   automatically mapped to Pfam PF12680
   automatically mapped to Pfam PF02136

6. Protein automated matches [260878] (1 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [260879] (3 PDB entries)

8. Domain d5g2gb_: 5g2g B: [319506]
   automated match to d3rgra_
   complexed with equ; mutant

Details for d5g2gb_

PDB Entry: 5g2g, 1.6 Å

PDB Description: crystal structure of ketosteroid isomerase containing m116k mutation in the equilenin-bound form

PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d5g2gb_:

Sequence; same for both SEQRES and ATOM records:

>d5g2gb_ d.17.4.3 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
lptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqglg
ggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtkqaywse
vnlsvr

Timeline for d5g2gb_:

• d5g2gb_ first appeared in SCOPe 2.06
  
• d5g2gb_ appears in SCOPe 2.07