Lineage for d1cjma_ (1cjm A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23081Family c.37.1.5: PAPS sulfotransferase [52575] (4 proteins)
  6. 23082Protein Aryl sulfotransferase sult1a3 [52580] (1 species)
  7. 23083Species Human (Homo sapiens) [TaxId:9606] [52581] (1 PDB entry)
  8. 23084Domain d1cjma_: 1cjm A: [31950]

Details for d1cjma_

PDB Entry: 1cjm (more details), 2.4 Å

PDB Description: human sult1a3 with sulfate bound

SCOP Domain Sequences for d1cjma_:

Sequence, based on SEQRES records: (download)

>d1cjma_ c.37.1.5 (A:) Aryl sulfotransferase sult1a3 {Human (Homo sapiens)}
srppleyvkgvplikyfaealgplqsfqarpddllintypksgttwvsqildmiyqggdl
ekcnrapiyvrvpflevndpgepsgletlkdtppprlikshlplallpqtlldqkvkvvy
varnpkdvavsyyhfhrmekahpepgtwdsflekfmagevsygswyqhvqewwelsrthp
vlylfyedmkenpkreiqkilefvgrslpeetmdfmvqhtsfkemkknpmtnyttvpqel
mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrs

Sequence, based on observed residues (ATOM records): (download)

>d1cjma_ c.37.1.5 (A:) Aryl sulfotransferase sult1a3 {Human (Homo sapiens)}
srppleyvkgvplikyfaealgplqsfqarpddllintypksgttwvsqildmiyqrvpf
levndpgepetlkdtppprlikshlplallpqtlldqkvkvvyvarnpkdvavsyyhfhr
mekahpepgtwdsflekfmagevsygswyqhvqewwelsrthpvlylfyedmkenpkrei
qkilefvgrslgdwkttftvaqnerfdadyaekmagcslsfrs

SCOP Domain Coordinates for d1cjma_:

Click to download the PDB-style file with coordinates for d1cjma_.
(The format of our PDB-style files is described here.)

Timeline for d1cjma_: