Lineage for d1efhb_ (1efh B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484015Family c.37.1.5: PAPS sulfotransferase [52575] (12 proteins)
    Pfam 00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 484054Protein Hydroxysteroid sulfotransferase sult2a1 [52578] (1 species)
  7. 484055Species Human (Homo sapiens) [TaxId:9606] [52579] (3 PDB entries)
  8. 484058Domain d1efhb_: 1efh B: [31949]

Details for d1efhb_

PDB Entry: 1efh (more details), 2.4 Å

PDB Description: crystal structure of the human hydroxysteroid sulfotransferase in the presence of pap

SCOP Domain Sequences for d1efhb_:

Sequence, based on SEQRES records: (download)

>d1efhb_ c.37.1.5 (B:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens)}
dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdka
qllrkgvsgdwknhftvaqaedfdklfqekmadlprklaaaleh

Sequence, based on observed residues (ATOM records): (download)

>d1efhb_ c.37.1.5 (B:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens)}
dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvkaql
lrkgvsgdwknhftvaqaedfdklfqekmadlprklaaaleh

SCOP Domain Coordinates for d1efhb_:

Click to download the PDB-style file with coordinates for d1efhb_.
(The format of our PDB-style files is described here.)

Timeline for d1efhb_: