Lineage for d1efha_ (1efh A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393658Family c.37.1.5: PAPS sulfotransferase [52575] (10 proteins)
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 393691Protein Hydroxysteroid sulfotransferase sult2a1 [52578] (1 species)
  7. 393692Species Human (Homo sapiens) [TaxId:9606] [52579] (3 PDB entries)
  8. 393694Domain d1efha_: 1efh A: [31948]

Details for d1efha_

PDB Entry: 1efh (more details), 2.4 Å

PDB Description: crystal structure of the human hydroxysteroid sulfotransferase in the presence of pap

SCOP Domain Sequences for d1efha_:

Sequence, based on SEQRES records: (download)

>d1efha_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens)}
dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdka
qllrkgvsgdwknhftvaqaedfdklfqekmadlprklaaale

Sequence, based on observed residues (ATOM records): (download)

>d1efha_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens)}
dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdql
lrkgvsgdwknhftvaqaedfdklfqekmadlprklaaale

SCOP Domain Coordinates for d1efha_:

Click to download the PDB-style file with coordinates for d1efha_.
(The format of our PDB-style files is described here.)

Timeline for d1efha_: