Lineage for d5b6ma_ (5b6m A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877442Protein 1-Cys peroxiredoxin [52909] (3 species)
  7. 2877443Species Human (Homo sapiens) [TaxId:9606] [52910] (3 PDB entries)
  8. 2877446Domain d5b6ma_: 5b6m A: [319460]
    automated match to d1prxb_

Details for d5b6ma_

PDB Entry: 5b6m (more details), 2.5 Å

PDB Description: crystal structure of human peroxiredoxin 6 in reduced state
PDB Compounds: (A:) Peroxiredoxin-6

SCOPe Domain Sequences for d5b6ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b6ma_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]}
glllgdvapnfeanttvgrirfhdflgdswgilfshprdftpvcttelgraaklapefak
rnvklialsidsvedhlawskdinaynceepteklpfpiiddrnrelaillgmldpaekd
ekgmpvtarvvfvfgpdkklklsilypattgrnfdeilrvvislqltaekrvatpvdwkd
gdsvmvlptipeeeakklfpkgvftkelpsgkkylrytpqp

SCOPe Domain Coordinates for d5b6ma_:

Click to download the PDB-style file with coordinates for d5b6ma_.
(The format of our PDB-style files is described here.)

Timeline for d5b6ma_: