Lineage for d4xgsd1 (4xgs D:2-163)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (10 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.1: Ferritin [47241] (10 proteins) 
Protein Non-hem ferritin [63524] (7 species) 
Species Escherichia coli [TaxId:83333] [319417] (1 PDB entry) 
Domain d4xgsd1: 4xgs D:2-163 [319439]
Other proteins in same PDB: d4xgsa2, d4xgsb2, d4xgsc2, d4xgsd2, d4xgse2, d4xgsf2
automated match to d4reua_
complexed with gol, ofo, so4
Details for d4xgsd1
PDB Entry: 4xgs (more details), 2.25 Å
PDB Description: crystal structure analysis of novel iron uptake mechanism of gram- negative bacterial ferritin
PDB Compounds: (D:) FerritinSCOPe Domain Sequences for d4xgsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xgsd1 a.25.1.1 (D:2-163) Non-hem ferritin {Escherichia coli [TaxId: 83333]}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldt
SCOPe Domain Coordinates for d4xgsd1:
Click to download the PDB-style file with coordinates for d4xgsd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4xgsd1:
View in 3D
