Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Non-hem ferritin [63524] (7 species) |
Species Escherichia coli [TaxId:83333] [319417] (1 PDB entry) |
Domain d4xgsb1: 4xgs B:2-164 [319422] Other proteins in same PDB: d4xgsa2, d4xgsb2, d4xgsc2, d4xgsd2, d4xgse2, d4xgsf2 automated match to d4reua_ complexed with gol, ofo, so4 |
PDB Entry: 4xgs (more details), 2.25 Å
SCOPe Domain Sequences for d4xgsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xgsb1 a.25.1.1 (B:2-164) Non-hem ferritin {Escherichia coli [TaxId: 83333]} lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl tdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnflq wyvseqheeeklfksiidklslagksgeglyfidkelstldtq
Timeline for d4xgsb1: