Lineage for d4ydea_ (4yde A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726312Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2726441Family a.118.6.0: automated matches [267630] (1 protein)
    not a true family
  6. 2726442Protein automated matches [267683] (4 species)
    not a true protein
  7. 2726448Species Candida albicans [TaxId:237561] [319406] (1 PDB entry)
  8. 2726449Domain d4ydea_: 4yde A: [319407]
    automated match to d4l9pa_
    complexed with 4c7, edo, zn

Details for d4ydea_

PDB Entry: 4yde (more details), 2.7 Å

PDB Description: crystal structure of candida albicans protein farnesyltransferase binary complex with the isoprenoid farnesyldiphosphate
PDB Compounds: (A:) Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha

SCOPe Domain Sequences for d4ydea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ydea_ a.118.6.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
tdskydysditpvdinteepqicqilydedykqimgillslmkaeeyseralhitelgin
elashytiwiyrfnilknlpnrnlydeldwceeialdneknyqiwnyrqliigqimelnn
ndfdpyrefpileamlssdpknhhvwsyrkwlvdtfdlhndakelsfvdkvidtdlknns
awshrffllfskkhlatdntideelnyvkdkivkcpqnpstwnyllgiherfdrsitqle
efslqfvdlekdqvtssfaletlakiytqqkkynesrtvydllkskydpirsnfwdyqis
klt

SCOPe Domain Coordinates for d4ydea_:

Click to download the PDB-style file with coordinates for d4ydea_.
(The format of our PDB-style files is described here.)

Timeline for d4ydea_: