Lineage for d5fzua_ (5fzu A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385751Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2385752Protein automated matches [190445] (8 species)
    not a true protein
  7. 2385808Species Potato (Solanum tuberosum) [TaxId:4113] [226410] (9 PDB entries)
  8. 2385815Domain d5fzua_: 5fzu A: [319351]
    automated match to d5dzua_

Details for d5fzua_

PDB Entry: 5fzu (more details), 2.43 Å

PDB Description: crystal structure of n19d potato sti-kunitz bi-functional inhibitor of serine and aspartic proteases in space group p4322 and ph 7.2
PDB Compounds: (A:) kti-a protein

SCOPe Domain Sequences for d5fzua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fzua_ b.42.4.0 (A:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
plpkpvldtngkelnpdssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvgps
gtpvrfiplstnifedqllniqfniptvklcvsytiwkvgnlnayfrtmlletggtigqa
dnsyfkivksskigynllscpftsiiclrcpedqfcakvgvviqngkrrlalvnenpldv
lfqev

SCOPe Domain Coordinates for d5fzua_:

Click to download the PDB-style file with coordinates for d5fzua_.
(The format of our PDB-style files is described here.)

Timeline for d5fzua_: