Lineage for d5i4ob_ (5i4o B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529558Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2529736Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2529737Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2529803Domain d5i4ob_: 5i4o B: [319345]
    automated match to d4i03a_
    complexed with ca, v28, zn

Details for d5i4ob_

PDB Entry: 5i4o (more details), 2.05 Å

PDB Description: crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated triazole-linked carboxylate zinc-chelator water-soluble inhibitor (dc28).
PDB Compounds: (B:) Macrophage metalloelastase

SCOPe Domain Sequences for d5i4ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4ob_ d.92.1.11 (B:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
vwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfarga
hgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhqighslglg
hssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d5i4ob_:

Click to download the PDB-style file with coordinates for d5i4ob_.
(The format of our PDB-style files is described here.)

Timeline for d5i4ob_: