Lineage for d5dmra_ (5dmr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887468Species Moloney murine leukemia virus (isolate shinnick) [TaxId:928306] [319343] (1 PDB entry)
  8. 2887469Domain d5dmra_: 5dmr A: [319344]
    automated match to d3v1oa_

Details for d5dmra_

PDB Entry: 5dmr (more details), 2.8 Å

PDB Description: crystal structure of c-terminal domain of mouse erf1 in complex with rnase h domain of rt of moloney murine leukemia virus
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H p80

SCOPe Domain Sequences for d5dmra_:

Sequence, based on SEQRES records: (download)

>d5dmra_ c.55.3.0 (A:) automated matches {Moloney murine leukemia virus (isolate shinnick) [TaxId: 928306]}
pdltdqplpdadhtwytdgssllqegqrkagaavtteteviwakalpagtsaqraelial
tqalkmaegkklnvytdsryafatahihgeiyrrrglltsegkeiknkdeilallkalfl
pkrlsiihcpghqkghsaeargnrmadqaarkaaitetpd

Sequence, based on observed residues (ATOM records): (download)

>d5dmra_ c.55.3.0 (A:) automated matches {Moloney murine leukemia virus (isolate shinnick) [TaxId: 928306]}
pdltdqplpdadhtwytdgssllqrkagaavtteteviwakalpagtsaqraelialtqa
lkmaegkklnvytdsryafatahihgeeiknkdeilallkalflpkrlsiihcphsaear
gnrmadqaarkaaitetpd

SCOPe Domain Coordinates for d5dmra_:

Click to download the PDB-style file with coordinates for d5dmra_.
(The format of our PDB-style files is described here.)

Timeline for d5dmra_: