Lineage for d5ghva_ (5ghv A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220835Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 2220836Species Human (Homo sapiens) [TaxId:9606] [118132] (60 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 2220901Domain d5ghva_: 5ghv A: [319342]
    automated match to d3tuca_
    complexed with x5g

Details for d5ghva_

PDB Entry: 5ghv (more details), 2.8 Å

PDB Description: crystal structure of an inhibitor-bound syk
PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d5ghva_:

Sequence, based on SEQRES records: (download)

>d5ghva_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
dlmnlcwtydvenrpgfaavelrlrnyyydvvn

Sequence, based on observed residues (ATOM records): (download)

>d5ghva_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilknpalkdellaeanvmqq
ldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyle
esnfvhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfs
sksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwt
ydvenrpgfaavelrlrnyyydvvn

SCOPe Domain Coordinates for d5ghva_:

Click to download the PDB-style file with coordinates for d5ghva_.
(The format of our PDB-style files is described here.)

Timeline for d5ghva_: