SCOPe 2.06: Domain d5i4oa_: 5i4o A:

Lineage for d5i4oa_ (5i4o A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (47 PDB entries)

8. Domain d5i4oa_: 5i4o A: [319335]
   automated match to d4i03a_
   complexed with ca, v28, zn

Details for d5i4oa_

PDB Entry: 5i4o, 2.05 Å

PDB Description: crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated triazole-linked carboxylate zinc-chelator water-soluble inhibitor (dc28).

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d5i4oa_:

Sequence; same for both SEQRES and ATOM records:

>d5i4oa_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfarga
hgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhqighslglg
hssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d5i4oa_:

• d5i4oa_ is new in SCOPe 2.06-stable
  
• d5i4oa_ appears in SCOPe 2.07
  
• d5i4oa_ appears in the current release, SCOPe 2.08