Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein automated matches [190182] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186920] (47 PDB entries) |
Domain d5i4od_: 5i4o D: [319303] automated match to d4i03a_ complexed with ca, v28, zn |
PDB Entry: 5i4o (more details), 2.05 Å
SCOPe Domain Sequences for d5i4od_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i4od_ d.92.1.11 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfarga hgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhqighslglg hssdpkavmfptykyvdintfrlsaddirgiqslyg
Timeline for d5i4od_: