Lineage for d5ee5b_ (5ee5 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124193Protein ADP-ribosylation factor [52614] (16 species)
  7. 2124238Species Human (Homo sapiens), ARL1 [TaxId:9606] [102364] (3 PDB entries)
  8. 2124247Domain d5ee5b_: 5ee5 B: [319297]
    automated match to d1upta_
    complexed with act, cl, gol, gtp, mg, na

Details for d5ee5b_

PDB Entry: 5ee5 (more details), 2.28 Å

PDB Description: structure of human arl1 in complex with the dcb domain of big1
PDB Compounds: (B:) ADP-ribosylation factor-like protein 1

SCOPe Domain Sequences for d5ee5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ee5b_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}
emrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggltsirp
ywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamts
semanslglpalkdrkwqifktsatkgtgldeamewlvetlksr

SCOPe Domain Coordinates for d5ee5b_:

Click to download the PDB-style file with coordinates for d5ee5b_.
(The format of our PDB-style files is described here.)

Timeline for d5ee5b_: