Lineage for d5a62a_ (5a62 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152830Species Candidatus nitrososphaera [TaxId:497727] [319280] (1 PDB entry)
  8. 2152831Domain d5a62a_: 5a62 A: [319281]
    automated match to d1hkha_
    complexed with act

Details for d5a62a_

PDB Entry: 5a62 (more details), 1.5 Å

PDB Description: hydrolytic potential of the ammonia-oxidizing thaumarchaeon nitrososphaera gargenis - crystal structure and activity profiles of carboxylesterases linked to their metabolic function
PDB Compounds: (A:) putative alpha/beta hydrolase fold protein

SCOPe Domain Sequences for d5a62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a62a_ c.69.1.0 (A:) automated matches {Candidatus nitrososphaera [TaxId: 497727]}
pflsspsnsvstyyedhgdarsyplvlihpiggniliwdyeiqlllksgfrviayelrgh
hrtnmgktgaytmqdliddlrrllehlnigkctiighsiggiissmyaaqhpgkvdaiim
ingspkkfqekdlekhfrtrevaitqgmkalaehklvsldeardlfadkrhadffrevft
ktsvegfvaatvalytipgnvvqglrasgckvfaivgsdddvfmrliketkeeipemelr
vlqgsdhwvviekpkemydilmgflaivtkdv

SCOPe Domain Coordinates for d5a62a_:

Click to download the PDB-style file with coordinates for d5a62a_.
(The format of our PDB-style files is described here.)

Timeline for d5a62a_: