Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) |
Family c.23.8.0: automated matches [191522] (1 protein) not a true family |
Protein automated matches [190879] (8 species) not a true protein |
Species Treponema denticola [TaxId:243275] [319248] (1 PDB entry) |
Domain d5c5da_: 5c5d A: [319249] automated match to d3rg8g_ complexed with edo |
PDB Entry: 5c5d (more details), 1.69 Å
SCOPe Domain Sequences for d5c5da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c5da_ c.23.8.0 (A:) automated matches {Treponema denticola [TaxId: 243275]} rplviilmgsssdmghaekiaselktfgieyairigdahktaehvvsmlkeyealdrpkl yitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepknaa llaarifslydkeiadsvksymesnaqkiieddsklkr
Timeline for d5c5da_: