SCOPe 2.08: Domain d5a4wf1: 5a4w F:3-86

Lineage for d5a4wf1 (5a4w F:3-86)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein automated matches [227019] (4 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318873] (4 PDB entries)

8. Domain d5a4wf1: 5a4w F:3-86 [319206]
   Other proteins in same PDB: d5a4wa2, d5a4wb2, d5a4wc2, d5a4wd2, d5a4we2, d5a4wf2
   automated match to d1gnwa2
   complexed with act, qct

Details for d5a4wf1

PDB Entry: 5a4w, 2.25 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with quercetrin

PDB Compounds: (F:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a4wf1:

Sequence; same for both SEQRES and ATOM records:

>d5a4wf1 c.47.1.5 (F:3-86) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnl

Timeline for d5a4wf1:

• d5a4wf1 first appeared in SCOPe 2.06
  
• d5a4wf1 appears in SCOPe 2.07