SCOPe 2.08: Domain d5a4vb2: 5a4v B:87-212

Lineage for d5a4vb2 (5a4v B:87-212)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318877] (4 PDB entries)

8. Domain d5a4vb2: 5a4v B:87-212 [319205]
   Other proteins in same PDB: d5a4va1, d5a4vb1, d5a4vc1, d5a4vd1, d5a4ve1, d5a4vf1
   automated match to d1gnwa1
   complexed with act, que

Details for d5a4vb2

PDB Entry: 5a4v, 2.38 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with quercetin

PDB Compounds: (B:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a4vb2:

Sequence; same for both SEQRES and ATOM records:

>d5a4vb2 a.45.1.1 (B:87-212) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq

Timeline for d5a4vb2:

• d5a4vb2 first appeared in SCOPe 2.06
  
• d5a4vb2 appears in SCOPe 2.07