Lineage for d4zepb_ (4zep B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832754Species Geobacillus stearothermophilus [TaxId:1422] [319127] (16 PDB entries)
  8. 2832796Domain d4zepb_: 4zep B: [319152]
    automated match to d1pbga_
    complexed with bg6, gol, imd

Details for d4zepb_

PDB Entry: 4zep (more details), 2.21 Å

PDB Description: structure of gan1d, a 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-glucose
PDB Compounds: (B:) Putative 6-phospho-beta-galactobiosidase

SCOPe Domain Sequences for d4zepb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zepb_ c.1.8.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael

SCOPe Domain Coordinates for d4zepb_:

Click to download the PDB-style file with coordinates for d4zepb_.
(The format of our PDB-style files is described here.)

Timeline for d4zepb_: