Lineage for d4zehb_ (4zeh B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095588Species Geobacillus stearothermophilus [TaxId:1422] [319127] (17 PDB entries)
  8. 2095606Domain d4zehb_: 4zeh B: [319146]
    automated match to d1pbga_
    complexed with imd, mpd

Details for d4zehb_

PDB Entry: 4zeh (more details), 1.33 Å

PDB Description: high resolution structure of gan1d, a putative 6-phospho-beta- galactosidase from geobacillus stearothermophilus
PDB Compounds: (B:) Putative 6-phospho-beta-galactobiosidase

SCOPe Domain Sequences for d4zehb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zehb_ c.1.8.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyh
ryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtl
yhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlg
lhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvla
fenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyq
tttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglrig
lrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgy
cawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael

SCOPe Domain Coordinates for d4zehb_:

Click to download the PDB-style file with coordinates for d4zehb_.
(The format of our PDB-style files is described here.)

Timeline for d4zehb_:

  • d4zehb_ appears in periodic updates to SCOPe 2.06 starting on 2016-06-30
  • d4zehb_ became obsolete in SCOPe 2.07