Lineage for d4zxoa1 (4zxo A:30-366)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095372Species Bacteroides ovatus [TaxId:28116] [319143] (1 PDB entry)
  8. 2095373Domain d4zxoa1: 4zxo A:30-366 [319144]
    Other proteins in same PDB: d4zxoa2
    automated match to d4cd5a_
    complexed with k, po4

Details for d4zxoa1

PDB Entry: 4zxo (more details), 1.5 Å

PDB Description: the structure of a gh26 beta-mannanase from bacteroides ovatus, boman26a.
PDB Compounds: (A:) Glycosyl hydrolase family 26

SCOPe Domain Sequences for d4zxoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zxoa1 c.1.8.0 (A:30-366) automated matches {Bacteroides ovatus [TaxId: 28116]}
ktpetvallqnlkqaerkgilfghhddtaygigwegdkgrsdvksvcgaypgvmsfdlge
ielggthnldkvsfahlreyiieqyarggmislswhvrnpktggdswdvtdstvvasvmq
ggenhvkmlewidrvadfllslktkegvlipvvfrpwhehtgswfwwgkdlcsseqyktl
wrmtndrlrlkgvnnvllayspgmesdtveeylerypgddiidvlgtdvyqfersqyikq
lnkmltilteagkkhdkpialtetglegipdslwwtgtllpviekyplsyvlvwrnarek
sthyyapypgqvsaddfvkfsrspkilfvgdnfelyk

SCOPe Domain Coordinates for d4zxoa1:

Click to download the PDB-style file with coordinates for d4zxoa1.
(The format of our PDB-style files is described here.)

Timeline for d4zxoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zxoa2