SCOPe 2.08: Domain d4zefa1: 4zef A:252-483

Lineage for d4zefa1 (4zef A:252-483)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [195543] (5 PDB entries)

8. Domain d4zefa1: 4zef A:252-483 [319136]
   Other proteins in same PDB: d4zefa2
   automated match to d4kqpa_
   complexed with gln

Details for d4zefa1

PDB Entry: 4zef, 1.4 Å

PDB Description: crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis

PDB Compounds: (A:) Amino acid ABC transporter amino acid-binding/permease

SCOPe Domain Sequences for d4zefa1:

Sequence; same for both SEQRES and ATOM records:

>d4zefa1 c.94.1.0 (A:252-483) automated matches {Enterococcus faecalis [TaxId: 226185]}
mkkitpkkekyviasdstfapfefqnaqgdyvgidvdlvkraaelqgftvefkfigfssa
vqavesgqadgmvagmtitddrkkafdfsvpyfdsgiqiavkkgndkiksyddlkgkkvg
vkigtesadfleknkkkydysikyldttdalysaleigevdammddypvigygvaqnqpl
atpiprekggsygfavkkgqnpellemfneglkemkrtgeydkiigtyvkdg

Timeline for d4zefa1:

• d4zefa1 first appeared in SCOPe 2.06
  
• d4zefa1 appears in SCOPe 2.07