SCOP 1.73: Domain d2eckb1: 2eck B:1-121,B:157-214

Lineage for d2eckb1 (2eck B:1-121,B:157-214)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Adenylate kinase [52554] (14 species)

7. Species Escherichia coli [TaxId:562] [52560] (6 PDB entries)
   contains a rudiment "zinc-finger" subdomain, residue 122-156

8. Domain d2eckb1: 2eck B:1-121,B:157-214 [31912]
   Other proteins in same PDB: d2ecka2, d2eckb2
   complexed with adp, amp

Details for d2eckb1

PDB Entry: 2eck, 2.8 Å

PDB Description: structure of phosphotransferase

PDB Compounds: (B:) adenylate kinase

SCOP Domain Sequences for d2eckb1:

Sequence; same for both SEQRES and ATOM records:

>d2eckb1 c.37.1.1 (B:1-121,B:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

Timeline for d2eckb1:

• d2eckb1 first appeared (with stable ids) in SCOP 1.55
  
• d2eckb1 appears in SCOP 1.71
  
• d2eckb1 appears in SCOP 1.75
  
• d2eckb1 appears in the current release, SCOPe 2.08