SCOPe 2.06: Domain d2n8ya1: 2n8y A:743-892

Lineage for d2n8ya1 (2n8y A:743-892)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (30 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (51 PDB entries)

8. Domain d2n8ya1: 2n8y A:743-892 [319116]
   Other proteins in same PDB: d2n8ya2
   automated match to d3gn4f_
   complexed with ca

Details for d2n8ya1

PDB Entry: 2n8y

PDB Description: holo form of calmodulin-like domain of human non-muscle alpha-actinin 1

PDB Compounds: (A:) Alpha-actinin-1

SCOPe Domain Sequences for d2n8ya1:

Sequence; same for both SEQRES and ATOM records:

>d2n8ya1 a.39.1.0 (A:743-892) automated matches {Human (Homo sapiens) [TaxId: 9606]}
isqeqmnefrasfnhfdrdhsgtlgpeefkaclislgydigndpqgeaefarimsivdpn
rlgvvtfqafidfmsretadtdtadqvmasfkilagdknyitmdelrrelppdqaeycia
rmapytgpdsvpgaldymsfstalygesdl

Timeline for d2n8ya1:

• d2n8ya1 is new in SCOPe 2.06-stable
  
• d2n8ya1 appears in SCOPe 2.07
  
• d2n8ya1 appears in the current release, SCOPe 2.08