Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein HIV-1 reverse transcriptase [56689] (4 species) |
Species Human immunodeficiency virus type 1 group m subtype b (isolate lw123) [TaxId:82834] [319106] (1 PDB entry) |
Domain d5k14b_: 5k14 B: [319107] Other proteins in same PDB: d5k14a2 automated match to d1rt1b1 complexed with ib1 |
PDB Entry: 5k14 (more details), 2.4 Å
SCOPe Domain Sequences for d5k14b_:
Sequence, based on SEQRES records: (download)
>d5k14b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 group m subtype b (isolate lw123) [TaxId: 82834]} etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikk kdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfr kytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymd dlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpiv lpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelae nreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndv kqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvkl wyql
>d5k14b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 group m subtype b (isolate lw123) [TaxId: 82834]} etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikk stkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrky taftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddl yvgsdleigqhrtkieelrqhllrwgltyelhpdkwtvqpivlpekdswtvndiqklvgk lnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpsk dliaeiqkqgqgqwtyqiyqepfknlktgkyartndvkqlteavqkittesiviwgktpk fklpiqketwetwwteywqatwipewefvntpplvklwyql
Timeline for d5k14b_: