Lineage for d4akeb1 (4ake B:1-121,B:157-214)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 242913Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 242914Protein Adenylate kinase [52554] (8 species)
  7. 242938Species Escherichia coli [TaxId:562] [52560] (6 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 122-156
  8. 242948Domain d4akeb1: 4ake B:1-121,B:157-214 [31910]
    Other proteins in same PDB: d4akea2, d4akeb2

Details for d4akeb1

PDB Entry: 4ake (more details), 2.2 Å

PDB Description: adenylate kinase

SCOP Domain Sequences for d4akeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4akeb1 c.37.1.1 (B:1-121,B:157-214) Adenylate kinase {Escherichia coli}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOP Domain Coordinates for d4akeb1:

Click to download the PDB-style file with coordinates for d4akeb1.
(The format of our PDB-style files is described here.)

Timeline for d4akeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4akeb2