![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Adenylate kinase [52554] (16 species) |
![]() | Species Escherichia coli [TaxId:562] [52560] (9 PDB entries) contains a rudiment "zinc-finger" subdomain, residue 122-156 |
![]() | Domain d4akeb1: 4ake B:1-121,B:157-214 [31910] Other proteins in same PDB: d4akea2, d4akeb2 |
PDB Entry: 4ake (more details), 2.2 Å
SCOPe Domain Sequences for d4akeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4akeb1 c.37.1.1 (B:1-121,B:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg
Timeline for d4akeb1: