Lineage for d5a4va2 (5a4v A:87-212)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713723Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318877] (4 PDB entries)
  8. 2713736Domain d5a4va2: 5a4v A:87-212 [319097]
    Other proteins in same PDB: d5a4va1, d5a4vb1, d5a4vc1, d5a4vd1, d5a4ve1, d5a4vf1
    automated match to d1gnwa1
    complexed with act, que

Details for d5a4va2

PDB Entry: 5a4v (more details), 2.38 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with quercetin
PDB Compounds: (A:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a4va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a4va2 a.45.1.1 (A:87-212) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq

SCOPe Domain Coordinates for d5a4va2:

Click to download the PDB-style file with coordinates for d5a4va2.
(The format of our PDB-style files is described here.)

Timeline for d5a4va2: