Lineage for d4akea1 (4ake A:1-121,A:157-214)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179165Protein Adenylate kinase [52554] (8 species)
  7. 179189Species Escherichia coli [TaxId:562] [52560] (6 PDB entries)
  8. 179198Domain d4akea1: 4ake A:1-121,A:157-214 [31909]
    Other proteins in same PDB: d4akea2, d4akeb2

Details for d4akea1

PDB Entry: 4ake (more details), 2.2 Å

PDB Description: adenylate kinase

SCOP Domain Sequences for d4akea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4akea1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOP Domain Coordinates for d4akea1:

Click to download the PDB-style file with coordinates for d4akea1.
(The format of our PDB-style files is described here.)

Timeline for d4akea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4akea2