Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein automated matches [227019] (4 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318873] (4 PDB entries) |
Domain d5a5kj1: 5a5k J:3-86 [319045] Other proteins in same PDB: d5a5ka2, d5a5kb2, d5a5kc2, d5a5kd2, d5a5ke2, d5a5kf2, d5a5kg2, d5a5kh2, d5a5ki2, d5a5kj2, d5a5kk2, d5a5kl2, d5a5km2, d5a5kn2, d5a5ko2, d5a5kp2, d5a5kq2, d5a5kr2, d5a5ks2, d5a5kt2, d5a5ku2, d5a5kv2, d5a5kw2, d5a5kx2 automated match to d1gnwa2 complexed with 7wb |
PDB Entry: 5a5k (more details), 2.77 Å
SCOPe Domain Sequences for d5a5kj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a5kj1 c.47.1.5 (J:3-86) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd lklfesraitqyiahryenqgtnl
Timeline for d5a5kj1:
View in 3D Domains from other chains: (mouse over for more information) d5a5ka1, d5a5ka2, d5a5kb1, d5a5kb2, d5a5kc1, d5a5kc2, d5a5kd1, d5a5kd2, d5a5ke1, d5a5ke2, d5a5kf1, d5a5kf2, d5a5kg1, d5a5kg2, d5a5kh1, d5a5kh2, d5a5ki1, d5a5ki2, d5a5kk1, d5a5kk2, d5a5kl1, d5a5kl2, d5a5km1, d5a5km2, d5a5kn1, d5a5kn2, d5a5ko1, d5a5ko2, d5a5kp1, d5a5kp2, d5a5kq1, d5a5kq2, d5a5kr1, d5a5kr2, d5a5ks1, d5a5ks2, d5a5kt1, d5a5kt2, d5a5ku1, d5a5ku2, d5a5kv1, d5a5kv2, d5a5kw1, d5a5kw2, d5a5kx1, d5a5kx2 |