Lineage for d5i4vf_ (5i4v F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2013232Domain d5i4vf_: 5i4v F: [319018]
    Other proteins in same PDB: d5i4vb2
    automated match to d4j5xc_
    complexed with 67s

Details for d5i4vf_

PDB Entry: 5i4v (more details), 2.61 Å

PDB Description: discovery of novel, orally efficacious liver x receptor (lxr) beta agonists
PDB Compounds: (F:) Retinoic acid receptor RXR-beta,Nuclear receptor coactivator 2

SCOPe Domain Sequences for d5i4vf_:

Sequence, based on SEQRES records: (download)

>d5i4vf_ a.123.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eempvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakr
iphfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgai
fdrvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyck
qkypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleagsgsgshk
ilhrllqd

Sequence, based on observed residues (ATOM records): (download)

>d5i4vf_ a.123.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eempvdrileaelavepvtnicqaadkqlftlvewakriphfsslplddqvillragwne
lliasfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktel
gclraiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrs
iglkclehlfffkligdtflmemleagshkilhrllqd

SCOPe Domain Coordinates for d5i4vf_:

Click to download the PDB-style file with coordinates for d5i4vf_.
(The format of our PDB-style files is described here.)

Timeline for d5i4vf_: