Lineage for d5fxch2 (5fxc H:1003-1106A)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347951Species Mouse (Mus musculus) [TaxId:10090] [186842] (175 PDB entries)
  8. 2348082Domain d5fxch2: 5fxc H:1003-1106A [319012]
    Other proteins in same PDB: d5fxch1, d5fxch3
    automated match to d1mfal1
    complexed with edo

Details for d5fxch2

PDB Entry: 5fxc (more details), 2.05 Å

PDB Description: crystal structure of glycopeptide 22 in complex with scfv-sm3
PDB Compounds: (H:) scfv-sm3

SCOPe Domain Sequences for d5fxch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fxch2 b.1.1.1 (H:1003-1106A) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOPe Domain Coordinates for d5fxch2:

Click to download the PDB-style file with coordinates for d5fxch2.
(The format of our PDB-style files is described here.)

Timeline for d5fxch2: