Lineage for d3aky_1 (3aky 3-130,169-220)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 proteins) Protein Adenylate kinase [52554] (8 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52559] (4 PDB entries) 
Domain d3aky_1: 3aky 3-130,169-220 [31898]
Other proteins in same PDB: d3aky_2
Details for d3aky_1
PDB Entry: 3aky (more details), 2.23 Å
PDB Description: stability, activity and structure of adenylate kinase mutants
SCOP Domain Sequences for d3aky_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aky_1 c.37.1.1 (3-130,169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
esirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqggl
vsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkvdd
ellvaritXnadalkkrlaayhaqtepivdfykktgiwagvdasqppatvwadflnklgk
n
SCOP Domain Coordinates for d3aky_1:
Click to download the PDB-style file with coordinates for d3aky_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3aky_1:
- d3aky_1 appears in SCOP 1.57
- d3aky_1 appears in the current release, SCOPe 2.08, called d3akya1
View in 3D
